Human PIK4CB monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11258
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms PI4K-BETA, PI4KIIIbeta, PI4Kbeta, PIK4CB, pi4K92
Accession Number NP_002642.1
Gene Symbols PIK4CB|PI4KB
Gene Id 5298
Applications WB, ELISA
Isotype kappa, Igg2b
Immunogen Sequence GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGS QLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMR SITTKLYDGFQYLTNGIM
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

PI4K-BETA, PI4KIIIbeta, PI4Kbeta, PIK4CB, pi4K92

Description

Mouse monoclonal antibody raised against a partial recombinant PIK4CB.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_002651

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.52 KDa).
Detection limit for recombinant GST tagged PIK4CB is approximately 3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*