Human POLS monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11291
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms LAK-1, POLK, TRF4, TRF4-1
Accession Number NP_008930
Gene Symbols POLS
Gene Id 11044
Applications WB, ELISA
Isotype kappa, Igg2b
Immunogen Sequence SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGL YLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKV LDKATVPIIKLTDQETEVKVDISFNMETG
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

LAK-1, POLK, TRF4, TRF4-1

Description

Mouse monoclonal antibody raised against a partial recombinant POLS.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_006999

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.73 KDa).
Western blot analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POLS monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control.
Detection limit for recombinant GST tagged POLS is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*