Human RDX monoclonal antibody (50 ug)
$376.00
In stock
Code:
101-11431
-
+

Product Description

Specifications

Size 50 ug
Protein Name / Synonyms DFNB24
Accession Number AAH47109
Gene Symbols RDX
Gene Id 5962
Applications WB, ELISA, IF
Isotype kappa, Igg2b
Immunogen Sequence MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLR EVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKF RAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQ HKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEM YGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLER AQLENEKEKREIAEKEKERIEREKEELMERLKQIEEQTIK AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAK SAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEE EATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQK NERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD KYKTLRQIRQGNTKQRIDEFEAM
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

DFNB24

Description

Mouse monoclonal antibody raised against a full length recombinant RDX.

Source

Specificity
Human

Gene Information

Gene Accession #
BC047109

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (89.87 KDa).
RDX monoclonal antibody. Western Blot analysis of RDX expression in human kidney.
Immunofluorescence of monoclonal antibody to RDX on HeLa cell. [antibody concentration 10 ug/ml]

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*