Human ST13 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11668
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms AAG2, FAM10A1, FAM10A4, FLJ27260, HIP, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, SNC6
Accession Number AAH15317
Gene Symbols ST13
Gene Id 6767
Applications WB, ELISA
Isotype kappa, Igg2a
Immunogen Sequence MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLT QEQFLLDSLFDLFNLIIF
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

AAG2, FAM10A1, FAM10A4, FLJ27260, HIP, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, SNC6

Description

Mouse monoclonal antibody raised against a full-length recombinant ST13.

Source

Specificity
Human

Gene Information

Gene Accession #
BC015317

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (32.12 KDa).
Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*