Human SYT7 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11719
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms IPCA-7, MGC150517, PCANAP7, SYT-VII
Accession Number NP_004191.2
Gene Symbols SYT7
Gene Id 9066
Applications WB, ELISA
Isotype kappa, Igg2a
Immunogen Sequence CQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAV NTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSP GSEEDEAHEGCSRENLGRI
Gene Names SYT7
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

IPCA-7, MGC150517, PCANAP7, SYT-VII

Description

Mouse monoclonal antibody raised against a partial recombinant SYT7.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_004200

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.63 KDa).
Detection limit for recombinant GST tagged SYT7 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*