Human TGIF2 monoclonal antibody (200 uL)
$376.00
In stock
Code:
101-11776
-
+

Product Description

Specifications

Size 200 ul
Protein Name / Synonyms None
Accession Number AAH12816
Gene Symbols TGIF2
Gene Id 60436
Applications WB, ELISA
Isotype kappa, Igg2b
Immunogen Sequence MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLH RYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDM LRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPA PTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTP GSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQL LVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

None

Description

Mouse monoclonal antibody raised against a full-length recombinant TGIF2.

Source

Specificity
Human

Gene Information

Gene Accession #
BC012816

Preparation

Storage Buffer
Ascites fluid

Western Blot detection against Immunogen (51.81 KDa).
Western Blot analysis of TGIF2 expression in transfected 293T cell line by TGIF2 monoclonal antibody. Lane 1: TGIF2 transfected lysate(25.9 KDa). Lane 2: Non-transfected lysate.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*