Human TLR6 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11796
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms CD286
Accession Number NP_006059
Gene Symbols TLR6
Gene Id 10333
Applications ELISA
Isotype kappa, Igg2b
Immunogen Sequence LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEY LNIYNLTIIESIREEDFTYS
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

CD286

Description

Mouse monoclonal antibody raised against a partial recombinant TLR6.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_006068

Preparation

Storage Buffer
1x PBS, pH 7.2

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*