Human ZAK monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11952
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms AZK, MLK7, MLT, MLTK, MRK, mlklak
Accession Number AAH01401.1
Gene Symbols ZAK
Gene Id 51776
Applications WB, ELISA, IF
Isotype kappa, Igg1
Immunogen Sequence MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDK EVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGI VTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY LHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNH TTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEML TREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLH QCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQ KLTEQSNTPLLLPLAARMSEESYFESKTEESNSAEMSCQI TATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGM QINMQAKQNSSKTTSKRRGKKVNMALGFSDFDLSEGDDDD DDDGEEEDNDMDNSE
Gene Names ZAK
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

AZK, MLK7, MLT, MLTK, MRK, mlklak

Description

Mouse monoclonal antibody raised against a full length recombinant ZAK.

Source

Specificity
Human

Gene Information

Gene Accession #
BC001401

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (75.79 KDa).
Immunofluorescence of monoclonal antibody to ZAK on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged ZAK is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*