pro-Brain Natriuretic Peptide (proBNP) (a.a. 1-108) Recombinant

12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence).

Purified, Lyophilized

Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer.

10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization).

Specifications

Size

10 ug

Stability & Storage

Storage/Stability

Store lyophilized product at 2-8°C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.

pro-Brain Natriuretic Peptide (proBNP) (a.a. 1-108) Recombinant

Purified, Lyophilized

Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer.

10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization).

Specifications

Size

10 ug

Stability & Storage

Storage/Stability

Store lyophilized product at 2-8°C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.

pro-Brain Natriuretic Peptide (proBNP) (a.a. 1-108) Recombinant

Size	10 µg
Estimated Lead Time	3-4 weeks
Species	Human
Expression System	E. coli
Purity Determined By	> 95% pure (SDS-PAGE).
Molecular Weight (kDa)	12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence).
Format	Purified, Lyophilized
Formulation	Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer.
Concentration (lot specific)	10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization).
Preservative	None
Recommended Applications	Specific methodologies have not been tested using this product.
Research Area	Neuroscience, Cardiovascular Disease
Shipping Type	Ambient temperature
Storage	-20°C

Size	10 µg
Estimated Lead Time	3-4 weeks
Species	Human
Expression System	E. coli
Purity Determined By	> 95% pure (SDS-PAGE).
Molecular Weight (kDa)	12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence).
Format	Purified, Lyophilized
Formulation	Lyophilized from 200 mM Ammonium Acetate, pH 7.0. Reconstitute in 10 uL of double distilled buffer.
Concentration (lot specific)	10 ug/mL (OD280nm, E0.1% = 0.59) (prior to lyophilization).
Preservative	None
Recommended Applications	Specific methodologies have not been tested using this product.
Research Area	Neuroscience, Cardiovascular Disease
Shipping Type	Ambient temperature
Storage	-20°C

Featured Products

Human pro-BNP (1-108) Recombinant

Product Description

Specifications

Specifications

Stability & Storage

Featured Products

Human pro-BNP (1-108) Recombinant

Product Description

Specifications

Specifications

Stability & Storage

Human pro-BNP (1-108) Recombinant

Human pro-BNP (1-108) Recombinant

Featured Products

Human pro-BNP (1-108) Recombinant

Product Description

Specifications

Specifications

Stability & Storage

Documents

Reviews

Ask A Question

Featured Products

Human pro-BNP (1-108) Recombinant

Product Description

Specifications

Specifications

Stability & Storage

Documents

Reviews

Ask A Question

Human pro-BNP (1-108) Recombinant

Human pro-BNP (1-108) Recombinant